Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Ochrobactrum anthropi ATP synthase subunit a 1 (atpB1)

This Recombinant Ochrobactrum anthropi ATP synthase subunit a 1 (atpB1) spans the amino acid sequence from region 1-249.

Product Specifications

Product Name Alternative

ATP synthase subunit a 1, ATP synthase F0 sector subunit a 1, F-ATPase subunit 6 1

UniProt

A6WW77

Expression Region

1-249

Origin

Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MANDPIHQFQVSRWIPIDVGGVDLSFTNVSAFMVATVVVASGFLYLTSSGRGLIPTRLQS VSEMAYEFVATSLRDSAGSKGMKFFPFVFSLFMFVLVANFLGLFPYFYTVTSQIIVTFAL AVLVIGTVIVYGFFKHGLGFLKLFVPSGVPGIIVPLVVAIEIISFLSRPISLSVRLFANM LAGHITLKVFAGFVVSLAALGPIGIGGAVLPLIMTVAITALEFLVAFLQAYVFTVLTCMY INDAVHPGH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCR2 Recombinant Rabbit Monoclonal Antibody [SN707]
ET1611-65 100 µL

CCR2 Recombinant Rabbit Monoclonal Antibody [SN707]

Sign In for Pricing
View Details
EYA3 Rabbit Polyclonal Antibody
TA376048 100 µL

EYA3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human AMAC1L2 (SLC35G5) activation kit by CRISPRa
GA113225 1 Kit

Human AMAC1L2 (SLC35G5) activation kit by CRISPRa

Sign In for Pricing
View Details
VPS26 (VPS26A) (NM_001035260) Human Over-expression Lysate
LC422131 20 µg

VPS26 (VPS26A) (NM_001035260) Human Over-expression Lysate

Sign In for Pricing
View Details
NFKB1 pSer907 Rabbit Polyclonal Antibody
AP01646PU-N 100 µg

NFKB1 pSer907 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TXNDC5 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1C1]
TA507261BM 100 µL

TXNDC5 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1C1]

Sign In for Pricing
View Details