Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Ochrobactrum anthropi ATP synthase subunit a 2 (atpB2)

This Recombinant Ochrobactrum anthropi ATP synthase subunit a 2 (atpB2) spans the amino acid sequence from region 1-249.

Product Specifications

Product Name Alternative

ATP synthase subunit a 2, ATP synthase F0 sector subunit a 2, F-ATPase subunit 6 2

UniProt

A6X1X3

Expression Region

1-249

Origin

Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAGPIEQFAIKPIVELGEIGGQPVAFTNSALFMVLTVLGAAAFMFLSSRRGTVVPGRWQS SAEILYEFVSKTLRENAGEKGMAFFPLVFSLFLFILFANLIGMFPYAFTVTSHIIVTFAL AMLVFLTVTIYGLVRHGFRFFRLFMPAGVPVVLAPIIVPIEIMSYISRPVSHSVRLFAVM LAGHITLKVFAGFVIGLGSLGTLGMLTAVLPLAMTVALTALELLMAVIQAYVFTMLTCMY LNDALHPSH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human TMEM196 Protein Lysate
MBS8428737-01 0.02 mg

Human TMEM196 Protein Lysate

Sign In for Pricing
View Details
Human TMEM196 Protein Lysate
MBS8428737-02 5x 0.02 mg

Human TMEM196 Protein Lysate

Sign In for Pricing
View Details
NFE2L1 Rabbit Polyclonal Antibody (BF405)
orb2468774 100 µL

NFE2L1 Rabbit Polyclonal Antibody (BF405)

Sign In for Pricing
View Details
HOXA6, ID (HOXA6, HOX1B, Homeobox protein Hox-A6, Homeobox protein Hox-1B) (MaxLight 650)
MBS6307756-01 0.1 mL

HOXA6, ID (HOXA6, HOX1B, Homeobox protein Hox-A6, Homeobox protein Hox-1B) (MaxLight 650)

Sign In for Pricing
View Details
HOXA6, ID (HOXA6, HOX1B, Homeobox protein Hox-A6, Homeobox protein Hox-1B) (MaxLight 650)
MBS6307756-02 5x 0.1 mL

HOXA6, ID (HOXA6, HOX1B, Homeobox protein Hox-A6, Homeobox protein Hox-1B) (MaxLight 650)

Sign In for Pricing
View Details
Mouse Monoclonal Antibody to KRT10
MBS8528614-01 0.1 mL

Mouse Monoclonal Antibody to KRT10

Sign In for Pricing
View Details