Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Ochrobactrum anthropi ATP synthase subunit a 2 (atpB2)

This Recombinant Ochrobactrum anthropi ATP synthase subunit a 2 (atpB2) spans the amino acid sequence from region 1-249.

Product Specifications

Product Name Alternative

ATP synthase subunit a 2, ATP synthase F0 sector subunit a 2, F-ATPase subunit 6 2

UniProt

A6X1X3

Expression Region

1-249

Origin

Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAGPIEQFAIKPIVELGEIGGQPVAFTNSALFMVLTVLGAAAFMFLSSRRGTVVPGRWQS SAEILYEFVSKTLRENAGEKGMAFFPLVFSLFLFILFANLIGMFPYAFTVTSHIIVTFAL AMLVFLTVTIYGLVRHGFRFFRLFMPAGVPVVLAPIIVPIEIMSYISRPVSHSVRLFAVM LAGHITLKVFAGFVIGLGSLGTLGMLTAVLPLAMTVALTALELLMAVIQAYVFTMLTCMY LNDALHPSH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat Polyclonal SDS3 Antibody [DyLight 594]
NB100-257DL594 0.1 mL

Goat Polyclonal SDS3 Antibody [DyLight 594]

Sign In for Pricing
View Details
SHARPIN Polyclonal Antibody, APC-Cy7 Conjugated
bs-9581R-APC-Cy7 100 µL

SHARPIN Polyclonal Antibody, APC-Cy7 Conjugated

Sign In for Pricing
View Details
Rabbit Anti-Human ADAMTS-19 Polyclonal Antibody
PA87533HU-01 50 µg

Rabbit Anti-Human ADAMTS-19 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human ADAMTS-19 Polyclonal Antibody
PA87533HU-02 100 µg

Rabbit Anti-Human ADAMTS-19 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human ADAMTS-19 Polyclonal Antibody
PA87533HU-03 500 µg

Rabbit Anti-Human ADAMTS-19 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human ADAMTS-19 Polyclonal Antibody
PA87533HU-04 1 mg

Rabbit Anti-Human ADAMTS-19 Polyclonal Antibody

Sign In for Pricing
View Details