Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Ochrobactrum anthropi ATP synthase subunit a 2 (atpB2)

This Recombinant Ochrobactrum anthropi ATP synthase subunit a 2 (atpB2) spans the amino acid sequence from region 1-249.

Product Specifications

Product Name Alternative

ATP synthase subunit a 2, ATP synthase F0 sector subunit a 2, F-ATPase subunit 6 2

UniProt

A6X1X3

Expression Region

1-249

Origin

Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAGPIEQFAIKPIVELGEIGGQPVAFTNSALFMVLTVLGAAAFMFLSSRRGTVVPGRWQS SAEILYEFVSKTLRENAGEKGMAFFPLVFSLFLFILFANLIGMFPYAFTVTSHIIVTFAL AMLVFLTVTIYGLVRHGFRFFRLFMPAGVPVVLAPIIVPIEIMSYISRPVSHSVRLFAVM LAGHITLKVFAGFVIGLGSLGTLGMLTAVLPLAMTVALTALELLMAVIQAYVFTMLTCMY LNDALHPSH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOC687707 sgRNA CRISPR Lentivector (Rat) (Target 3)
K6064904 1.0 µg DNA

LOC687707 sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Anti-Hu CD206 PE-Cy™7
T7-782-T100 100 Tests

Anti-Hu CD206 PE-Cy™7

Sign In for Pricing
View Details
Clca1 HDR Plasmid (m)
sc-423859-HDR 20 µg

Clca1 HDR Plasmid (m)

Sign In for Pricing
View Details
PNMA5 (NM_001103151) Human Tagged Lenti ORF Clone
RC222830L3 10 µg

PNMA5 (NM_001103151) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Cecropin-A Rabbit Polyclonal Antibody (BF488)
orb2458878 100 µL

Cecropin-A Rabbit Polyclonal Antibody (BF488)

Sign In for Pricing
View Details
KLF4-TAT Recombinant Protein
40-524-0025mg 0.025 mg

KLF4-TAT Recombinant Protein

Sign In for Pricing
View Details