Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Herpetosiphon aurantiacus Cobalamin synthase (cobS)

This Recombinant Herpetosiphon aurantiacus Cobalamin synthase (cobS) spans the amino acid sequence from region 1-249.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

A9AYY2

Expression Region

1-249

Origin

Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIKHLAEALRFLTILPIPGKPALSEQALVRSMVAFPLAGTLIGGLVAATWFGATWLWGTT TGSLCAILTWGAITSGLHLDGIADSADALFSWRSRERKLEIMKDSRIGTMGAIALISILL LKWLFVLGCGDLAWRALIVAPTLGRWVDIIGIFWFPPAAEGGLGRTFHDHTRRSDFWWAT SCAGLVAAGLLWWWAGLIFAVVIVATIIIARWMVRSLGGLTGDTYGALCEIAEMLVLAVV AALVNHQVL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SCGB1A1 (Uteroglobin, Clara Cell Phospholipid-binding Protein, CCPBP, Clara Cells 10kD Secretory Protein, CC10, Secretoglobin Family 1A Member 1, Urinary Protein 1, UP-1, UP1, Urine Protein 1, CC10, CCSP, UGB) (PE)
MBS6160136-01 0.1 mL

SCGB1A1 (Uteroglobin, Clara Cell Phospholipid-binding Protein, CCPBP, Clara Cells 10kD Secretory Protein, CC10, Secretoglobin Family 1A Member 1, Urinary Protein 1, UP-1, UP1, Urine Protein 1, CC10, CCSP, UGB) (PE)

Sign In for Pricing
View Details
SCGB1A1 (Uteroglobin, Clara Cell Phospholipid-binding Protein, CCPBP, Clara Cells 10kD Secretory Protein, CC10, Secretoglobin Family 1A Member 1, Urinary Protein 1, UP-1, UP1, Urine Protein 1, CC10, CCSP, UGB) (PE)
MBS6160136-02 5x 0.1 mL

SCGB1A1 (Uteroglobin, Clara Cell Phospholipid-binding Protein, CCPBP, Clara Cells 10kD Secretory Protein, CC10, Secretoglobin Family 1A Member 1, Urinary Protein 1, UP-1, UP1, Urine Protein 1, CC10, CCSP, UGB) (PE)

Sign In for Pricing
View Details
Interleukin-2 (IL-2) Receptor Protein (139-145)
036-07 200 µg

Interleukin-2 (IL-2) Receptor Protein (139-145)

Sign In for Pricing
View Details
Calcitonin (PCT) Rapid Test Kit
RNS92091-01 1 Test

Calcitonin (PCT) Rapid Test Kit

Sign In for Pricing
View Details
Calcitonin (PCT) Rapid Test Kit
RNS92091-02 20 Tests

Calcitonin (PCT) Rapid Test Kit

Sign In for Pricing
View Details
5-Aminolevulinic Acid Hydrochloride Salt
sc-262399C 100 g

5-Aminolevulinic Acid Hydrochloride Salt

Sign In for Pricing
View Details