Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Herpetosiphon aurantiacus Cobalamin synthase (cobS)

This Recombinant Herpetosiphon aurantiacus Cobalamin synthase (cobS) spans the amino acid sequence from region 1-249.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

A9AYY2

Expression Region

1-249

Origin

Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIKHLAEALRFLTILPIPGKPALSEQALVRSMVAFPLAGTLIGGLVAATWFGATWLWGTT TGSLCAILTWGAITSGLHLDGIADSADALFSWRSRERKLEIMKDSRIGTMGAIALISILL LKWLFVLGCGDLAWRALIVAPTLGRWVDIIGIFWFPPAAEGGLGRTFHDHTRRSDFWWAT SCAGLVAAGLLWWWAGLIFAVVIVATIIIARWMVRSLGGLTGDTYGALCEIAEMLVLAVV AALVNHQVL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MACROD2 Lentiviral Activation Particles (h)
sc-414497-LAC 200 µL

MACROD2 Lentiviral Activation Particles (h)

Sign In for Pricing
View Details
AS601245 discontinued
169933-01 1 mg

AS601245 discontinued

Sign In for Pricing
View Details
AS601245 discontinued
169933-02 5 mg

AS601245 discontinued

Sign In for Pricing
View Details
Lignoceryl (C24) 3'-LMO 15 umol scale
26-6624-15 1 Each

Lignoceryl (C24) 3'-LMO 15 umol scale

Sign In for Pricing
View Details
HIGD1C Adenovirus (Mouse)
23285054 1.0 mL

HIGD1C Adenovirus (Mouse)

Sign In for Pricing
View Details
Mouse Monoclonal MAML2 Antibody (MAML2/1302) [HRP]
NBP2-54588H 100 µL

Mouse Monoclonal MAML2 Antibody (MAML2/1302) [HRP]

Sign In for Pricing
View Details