Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Brucella abortus ATP synthase subunit a (atpB)

This Recombinant Brucella abortus ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-249.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

Q2YM92

Expression Region

1-249

Origin

Brucella abortus (strain 2308)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MANDPIHQFQVSRWIPIDVGGVDLSFTNVSAFMVATVVLASGFLYLTSSGRGLIPTRLQS VSEMAYEFVATSLRDSAGSKGMKFFPFVFSLFMFVLVANFIGLFPYFYTVTSQIIVTFAL SLLVIGTVIFYGFFKHGFGFLKLFVPSGVPGIIVPLVVLIEIISFLSRPISLSVRLFANM LAGHITLKVFAGFVVSLSSLGALGIGGAVLPLLMTVAITALEFLVAFLQAYVFTVLTCMY INDAVHPGH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GABA A Receptor alpha 1 (GABRA1) (NM_001127645) Human Over-expression Lysate
LC426831 20 µg

GABA A Receptor alpha 1 (GABRA1) (NM_001127645) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung: right lower lobe
CS716086 5x 5 µm

Tissue FFPE Sections, Lung: right lower lobe

Sign In for Pricing
View Details
KIF1C Polyclonal Antibody
E-AB-15156-01 20 µL

KIF1C Polyclonal Antibody

Sign In for Pricing
View Details
KIF1C Polyclonal Antibody
E-AB-15156-02 60 µL

KIF1C Polyclonal Antibody

Sign In for Pricing
View Details
KIF1C Polyclonal Antibody
E-AB-15156-03 120 µL

KIF1C Polyclonal Antibody

Sign In for Pricing
View Details
KIF1C Polyclonal Antibody
E-AB-15156-04 200 µL

KIF1C Polyclonal Antibody

Sign In for Pricing
View Details