Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Gluconobacter oxydans ATP synthase subunit a (atpB)

This Recombinant Gluconobacter oxydans ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-249.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

Q5FRW5

Expression Region

1-249

Origin

Gluconobacter oxydans (strain 621H) (Gluconobacter suboxydans)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAAGSTIDALGQFELHPVLGHLGEALRFSQSPLFMLIAAAVVLVFLYVGMRPAAVVPGRL QAAAEISYDFVHDLAVSTIGENGATFFPFVFAIFFFILAGNYLGLLPFSFTYTSHIAVTF GLAIMVFIISILASIRFQGVGFLKHFLPAGTPVWLAPLLVPIEIISFLSRPVSLSIRLFA NMVAGHVLLEVFAGFTIMLAGLGAFGHVLAIAPIAINIALTALELLVGVLQAYVFAILTC IYLREAVAH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AIF1 Recombinant Rabbit mAb, PE conjugated
orb1585266 100 µL

AIF1 Recombinant Rabbit mAb, PE conjugated

Sign In for Pricing
View Details
MYO1E Human siRNA Oligo Duplex (Locus ID 4643)
SR303052 1 Kit

MYO1E Human siRNA Oligo Duplex (Locus ID 4643)

Sign In for Pricing
View Details
Anti-Poliovirus Receptor/PVR Antibody Picoband® (monoclonal, 3B11E9) Fluoro594 Conjugated
M00664-3-Fluoro594 100 µg/Vial

Anti-Poliovirus Receptor/PVR Antibody Picoband® (monoclonal, 3B11E9) Fluoro594 Conjugated

Sign In for Pricing
View Details
Monkey Transcription factor SOX 10 (SOX10) ELISA kit
GTR10396185 96 Well

Monkey Transcription factor SOX 10 (SOX10) ELISA kit

Sign In for Pricing
View Details
BDH1 Protein Vector (Human) (pPM-N-D-C-HA)
PV326704 500 ng

BDH1 Protein Vector (Human) (pPM-N-D-C-HA)

Sign In for Pricing
View Details
TM16G antibody
MBS5301328-01 0.1 mg

TM16G antibody

Sign In for Pricing
View Details