Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Gluconobacter oxydans ATP synthase subunit a (atpB)

This Recombinant Gluconobacter oxydans ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-249.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

Q5FRW5

Expression Region

1-249

Origin

Gluconobacter oxydans (strain 621H) (Gluconobacter suboxydans)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAAGSTIDALGQFELHPVLGHLGEALRFSQSPLFMLIAAAVVLVFLYVGMRPAAVVPGRL QAAAEISYDFVHDLAVSTIGENGATFFPFVFAIFFFILAGNYLGLLPFSFTYTSHIAVTF GLAIMVFIISILASIRFQGVGFLKHFLPAGTPVWLAPLLVPIEIISFLSRPVSLSIRLFA NMVAGHVLLEVFAGFTIMLAGLGAFGHVLAIAPIAINIALTALELLVGVLQAYVFAILTC IYLREAVAH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nme1 ORF Vector (Rat) (pORF)
ORF071367 1.0 µg DNA

Nme1 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Palm (NM_023128) Mouse Tagged ORF Clone Lentiviral Particle
MR226340L3V 200 µL

Palm (NM_023128) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Lentiviral human NSG2 shRNA (UAS) - Lentiviral human NSG2 shRNA (UAS, GFP) (25)
GTR15087332 1 Vial

Lentiviral human NSG2 shRNA (UAS) - Lentiviral human NSG2 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
KRT40 Antibody, HRP conjugated
A57436-50UG 50 µg

KRT40 Antibody, HRP conjugated

Sign In for Pricing
View Details
CASP1 AAV Vector (Rat) (CMV)
15062106 1 µg

CASP1 AAV Vector (Rat) (CMV)

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli O7:K1 (strain IAI39/ExPEC) APAH Polyclonal Antibody
MBS7175010 Inquire

Rabbit anti-Escherichia coli O7:K1 (strain IAI39/ExPEC) APAH Polyclonal Antibody

Sign In for Pricing
View Details