Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Gluconobacter oxydans ATP synthase subunit a (atpB)

This Recombinant Gluconobacter oxydans ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-249.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

Q5FRW5

Expression Region

1-249

Origin

Gluconobacter oxydans (strain 621H) (Gluconobacter suboxydans)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAAGSTIDALGQFELHPVLGHLGEALRFSQSPLFMLIAAAVVLVFLYVGMRPAAVVPGRL QAAAEISYDFVHDLAVSTIGENGATFFPFVFAIFFFILAGNYLGLLPFSFTYTSHIAVTF GLAIMVFIISILASIRFQGVGFLKHFLPAGTPVWLAPLLVPIEIISFLSRPVSLSIRLFA NMVAGHVLLEVFAGFTIMLAGLGAFGHVLAIAPIAINIALTALELLVGVLQAYVFAILTC IYLREAVAH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Galectin-3-binding protein (LGALS3BP) ELISA Kit
RK11405 96 Tests

Human Galectin-3-binding protein (LGALS3BP) ELISA Kit

Sign In for Pricing
View Details
Goose Actinin Alpha 4 ELISA Kit
MBS052685 Inquire

Goose Actinin Alpha 4 ELISA Kit

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli (strain K12) YCCS Polyclonal Antibody
MBS7148493 Inquire

Rabbit anti-Escherichia coli (strain K12) YCCS Polyclonal Antibody

Sign In for Pricing
View Details
LN28B Polyclonal Antibody
JOT-AP10943-01 20 µL

LN28B Polyclonal Antibody

Sign In for Pricing
View Details
LN28B Polyclonal Antibody
JOT-AP10943-02 50 μL

LN28B Polyclonal Antibody

Sign In for Pricing
View Details
LN28B Polyclonal Antibody
JOT-AP10943-03 100 µL

LN28B Polyclonal Antibody

Sign In for Pricing
View Details