Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanosarcina acetivorans Tetrahydromethanopterin S-methyltransferase subunit D (mtrD)

This Recombinant Methanosarcina acetivorans Tetrahydromethanopterin S-methyltransferase subunit D (mtrD) spans the amino acid sequence from region 1-249.

Product Specifications

Product Name Alternative

Tetrahydromethanopterin S-methyltransferase subunit D, EC= 2.1.1.86, N5-methyltetrahydromethanopterin--coenzyme M methyltransferase subunit D

UniProt

Q8TU00

Expression Region

1-249

Origin

Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIDALMANILWLVFIIIGGVLISWSVHFVPVGGAPAAMAQATGIGTGTVQLAAGAGLTGL VSAGFMMNVTDNLPLILASGAVGAMIMISVTMIVGTWVYVYGVGCVPSSAKVKYDPITKY RQDLYVSQGTEGHGLPTVSFVSGVIGGLLGGIGGALVYYSLIEVGLTAGLSTGTSSGVTG HELVGIAAMFAIGIFFVNAVIPSYNIGGTIEGFHDPKWKKWPKAVISSFVATILCAIVAV IAISQLGGI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P27 / KIP1 (SX53G8), CF640R conjugate, 0.1mg/mL
BNC400669-100 1x 100 µL

P27 / KIP1 (SX53G8), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11c (HC1/1), CF680R conjugate, 0.1mg/mL
BNC810152-500 1x 500 µL

CD11c (HC1/1), CF680R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (C8/1035), CF640R conjugate, 0.1mg/mL
BNC401035-500 1x 500 µL

CD8 (C8/1035), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF647 conjugate, 0.1mg/mL
BNC470965-500 1x 500 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF555 conjugate, 0.1mg/mL
BNC550017-100 1x 100 µL

Ep-CAM / CD326 (VU-1D9), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 (IAP/964 + B6H12.2), CF647 conjugate, 0.1mg/mL
BNC471029-500 1x 500 µL

CD47 (IAP/964 + B6H12.2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details