Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pyrococcus furiosus Molybdate/tungstate transport system permease protein wtpB (wtpB)

This Recombinant Pyrococcus furiosus Molybdate/tungstate transport system permease protein wtpB (wtpB) spans the amino acid sequence from region 1-249.

Product Specifications

Product Name Alternative

Molybdate/tungstate transport system permease protein wtpB

UniProt

Q8U4K4

Expression Region

1-249

Origin

Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDRRDYLAYAFAGLGAFLVAFIGLPLFMIFIKQAYDLEALQRTLVDPLVIESIRNSLFTA TVSTLLGILFGVPLGYVLARKEFKGKNFVQALIDTPIVIPHSVVGIMLLVTFSDAILDNY KGIVAVMLFVSSPFIVNSARDGFLSVDEKLEYVARTLGASGLRTFFSVTLPNAIHSIASG AIMAWARAISEVGAILIVAYYPKTAQVLIMEYFNNYGLRASRPIAVILVTISLAVFIFLR WLVGRGRNA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (CRIS-7), CF405S conjugate, 0.1mg/mL
BNC041050-100 1x 100 µL

CD3e (CRIS-7), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (Fn-3), CF640R conjugate, 0.1mg/mL
BNC402848-100 1x 100 µL

Fibronectin (Fn-3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD35 / CR1 (E11), CF405S conjugate, 0.1mg/mL
BNC040040-500 1x 500 µL

CD35 / CR1 (E11), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Calbindin 1 (CALB1) (CALB1/2782), CF640R conjugate, 0.1mg/mL
BNC402782-500 1x 500 µL

Calbindin 1 (CALB1) (CALB1/2782), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Thymidylate Synthase (TS106), CF740 conjugate, 0.1mg/mL
BNC740714-500 1x 500 µL

Thymidylate Synthase (TS106), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tenascin C (Stromal Marker For Epithelial Malignancy) (TNC/2981R), CF568 conjugate, 0.1mg/mL
BNC682981-100 1x 100 µL

Tenascin C (Stromal Marker For Epithelial Malignancy) (TNC/2981R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details