Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Zea mays Aquaporin SIP2-1 (SIP2-1)

This Recombinant Zea mays Aquaporin SIP2-1 (SIP2-1) spans the amino acid sequence from region 1-249.

Product Specifications

Product Name Alternative

Aquaporin SIP2-1, Small basic intrinsic protein 2-1, ZmSIP2-1, ZmSIP2;1

UniProt

Q9ATM1

Expression Region

1-249

Origin

Zea mays (Maize)

Field of Research

Kidney & Urological Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSPAPSRPRIRPWLVVGDLALAAAWVCAGALVKLLVYGGLGLGGRPEAEAVKVSLSLVYM FLFAWLEAASGGASYNPLTVLAAALASHGGPAVYLFTAFARIPAQVIGAVLGVKLIQVTF PNVGKGARLSVGAHHGALAEGLATFMVVMVSVTLKKKEMKSFFMKTWITSIWKNTIHLLS SDITGGIMNPASAFAWAYARGDHTTFDHLLVYWLAPLQATLLGVWAVTFFTKPKKIKEQK VDENKIKKE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fibronectin (HFN7.1), CF740 conjugate, 0.1mg/mL
BNC740270-100 1x 100 µL

Fibronectin (HFN7.1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P27 / KIP1 (SX53G8), CF740 conjugate, 0.1mg/mL
BNC740669-500 1x 500 µL

P27 / KIP1 (SX53G8), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD28 (204.12), CF405S conjugate, 0.1mg/mL
BNC040164-100 1x 100 µL

CD28 (204.12), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD5 (Cris-1), CF740 conjugate, 0.1mg/mL
BNC740176-500 1x 500 µL

CD5 (Cris-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF640R conjugate, 0.1mg/mL
BNC400160-500 1x 500 µL

CD20 (B9E9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF647 conjugate, 0.1mg/mL
BNC470630-100 1x 100 µL

Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details