Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Zea mays Aquaporin TIP4-3 (TIP4-3)

This Recombinant Zea mays Aquaporin TIP4-3 (TIP4-3) spans the amino acid sequence from region 1-249.

Product Specifications

Product Name Alternative

Aquaporin TIP4-3, Tonoplast intrinsic protein 4-3, ZmTIP4-3, ZmTIP4;3

UniProt

Q9ATL4

Expression Region

1-249

Origin

Zea mays (Maize)

Field of Research

Kidney & Urological Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGKLTLGHRGEASEPDFFRGVLGELVLTFLFVFIGVGAAMTDGATTKGSTAGGDLTAVAL GQALVVAVIATAGFHISGGHVNPAVTLSLAVGGHVTLFRSSLYIAAQMLASSAACFLLRW LTGGLATPVHALAEGVGPLQGVVAEAVFTFSLLFVIYATILDPRKLLPGAGPLLTGLLVG ANSVAGAALSGASMNPARSFGPAVASGVWTHHWVYWVGPLAGGPLAVLVYECCFMAAAPT HDLLPQQDP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD7 (T3-3A1), CF405S conjugate, 0.1mg/mL
BNC040978-500 1x 500 µL

CD7 (T3-3A1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (186-2G9), CF640R conjugate, 0.1mg/mL
BNC400178-500 1x 500 µL

CD50 (ICAM-3) (186-2G9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Chromogranin A (CHGA/413), CF640R conjugate, 0.1mg/mL
BNC400413-500 1x 500 µL

Chromogranin A (CHGA/413), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (Membrane Metalloendopeptidase) (MME/2590), CF405S conjugate, 0.1mg/mL
BNC042590-500 1x 500 µL

CD10 (Membrane Metalloendopeptidase) (MME/2590), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Calbindin 1 (CALB1) (CALB1/2782), CF647 conjugate, 0.1mg/mL
BNC472782-500 1x 500 µL

Calbindin 1 (CALB1) (CALB1/2782), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Involucrin (SY5), CF568 conjugate, 0.1mg/mL
BNC680678-500 1x 500 µL

Involucrin (SY5), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details