Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Vanderwaltozyma polyspora ATP synthase subunit a (ATP6)

This Recombinant Vanderwaltozyma polyspora ATP synthase subunit a (ATP6) spans the amino acid sequence from region 6-254.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase subunit 6, F-ATPase protein 6

UniProt

A6H4Q8

Expression Region

6-254

Origin

Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) (Kluyveromyces polysporus)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SPLDQFEMNTLLKFVTPFFDMSNLNITTFGLYIIIVLMVIVSLNILTTNNNTIIGSRWNL PLEMIYDTILNTTKGQIGGKLWGLYFPLIYTLFMFILIANLISLIPYSFALTAQIVFVIS LSFIIWLGSTITGFNKHGWLFFSLFVPNGTPTPLVPLLVIIESLSYIARAFSLGLRLTCN ILAGHLLMVILGGLLLNFININKLTLILGIIPFAMILAILCLEFAIAMIQSYVFATLTAS YIKDSLYLH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine ATP binding cassette sub family B member 9 (ABCB9) ELISA kit
GTR10371843 96 Well

Porcine ATP binding cassette sub family B member 9 (ABCB9) ELISA kit

Sign In for Pricing
View Details
HBV xAg (X36C) AC
sc-57760 AC 500 µg/mL - 25% ag

HBV xAg (X36C) AC

Sign In for Pricing
View Details
Tygon XL-60, 1.60 x 1.60 mm, PU=15 m
1214574 15 PK

Tygon XL-60, 1.60 x 1.60 mm, PU=15 m

Sign In for Pricing
View Details
DUSP5 Recombinant Rabbit Monoclonal Antibody
orb1499335-01 25 µL

DUSP5 Recombinant Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
DUSP5 Recombinant Rabbit Monoclonal Antibody
orb1499335-02 50 μL

DUSP5 Recombinant Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
DUSP5 Recombinant Rabbit Monoclonal Antibody
orb1499335-03 100 µL

DUSP5 Recombinant Rabbit Monoclonal Antibody

Sign In for Pricing
View Details