Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Vanderwaltozyma polyspora ATP synthase subunit a (ATP6)

This Recombinant Vanderwaltozyma polyspora ATP synthase subunit a (ATP6) spans the amino acid sequence from region 6-254.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase subunit 6, F-ATPase protein 6

UniProt

A6H4Q8

Expression Region

6-254

Origin

Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) (Kluyveromyces polysporus)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SPLDQFEMNTLLKFVTPFFDMSNLNITTFGLYIIIVLMVIVSLNILTTNNNTIIGSRWNL PLEMIYDTILNTTKGQIGGKLWGLYFPLIYTLFMFILIANLISLIPYSFALTAQIVFVIS LSFIIWLGSTITGFNKHGWLFFSLFVPNGTPTPLVPLLVIIESLSYIARAFSLGLRLTCN ILAGHLLMVILGGLLLNFININKLTLILGIIPFAMILAILCLEFAIAMIQSYVFATLTAS YIKDSLYLH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MYPOP CRISPRa sgRNA lentivector (set of three targets)(Human)
31336121 3x 1.0µg DNA

MYPOP CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
Hsa-miR-626 inhibitor
HY-RI01897-01 5 nmol

Hsa-miR-626 inhibitor

Sign In for Pricing
View Details
Hsa-miR-626 inhibitor
HY-RI01897-02 20 nmol

Hsa-miR-626 inhibitor

Sign In for Pricing
View Details
MAGI-2 Double Nickase Plasmid (m2)
sc-424504-NIC-2 20 µg

MAGI-2 Double Nickase Plasmid (m2)

Sign In for Pricing
View Details
Palladium 10% On Activated Carbon
52944-01 1 g

Palladium 10% On Activated Carbon

Sign In for Pricing
View Details
Palladium 10% On Activated Carbon
52944-02 10 g

Palladium 10% On Activated Carbon

Sign In for Pricing
View Details