Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Gluconacetobacter diazotrophicus ATP synthase subunit a (atpB)

This Recombinant Gluconacetobacter diazotrophicus ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-249.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

A9HDN1

Expression Region

1-249

Origin

Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAAGSTIDALGQFELHPVLGGLGESLRFSQSPVMMIVASVLVLAFLYVGMRPAAIVPGRL QAAAEICYDFIHDMAVDTIGPEGRAFFPFIFTLFFFILAGNYLGLLPFSFAFTSHIAVTL ALALLVFVLAVIVSLKAQGPKFFAHFMPAGAPVALAPLLVPIEILSFLSRPVSLSIRLFA NMVAGHVMLEMFAAFTIMLAGLGLFGDVLAVGPVVINVALMALELLVGALQAYVFAILTC IYLREAVAH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Carbadox
TRC-C175825-5G 5 g

Carbadox

Sign In for Pricing
View Details
CXCL7 (PPBP) (NM_002704) Human Recombinant Protein
TP307018L 1 mg

CXCL7 (PPBP) (NM_002704) Human Recombinant Protein

Sign In for Pricing
View Details
SHISAL2B (NM_001164442) Human Over-expression Lysate
LY431122 100 µg

SHISAL2B (NM_001164442) Human Over-expression Lysate

Sign In for Pricing
View Details
GOSR1 (NM_001007025) Human Over-expression Lysate
LC423567 20 µg

GOSR1 (NM_001007025) Human Over-expression Lysate

Sign In for Pricing
View Details
S adenosylhomocysteine hydrolase (AHCY) Human Gene Knockout Kit (CRISPR)
KN400724 1 Kit

S adenosylhomocysteine hydrolase (AHCY) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Amplite® Colorimetric NAD/NADH Ratio Assay Kit
15273-AAT 250 Tests

Amplite® Colorimetric NAD/NADH Ratio Assay Kit

Sign In for Pricing
View Details