Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Gluconacetobacter diazotrophicus ATP synthase subunit a (atpB)

This Recombinant Gluconacetobacter diazotrophicus ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-249.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

A9HDN1

Expression Region

1-249

Origin

Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAAGSTIDALGQFELHPVLGGLGESLRFSQSPVMMIVASVLVLAFLYVGMRPAAIVPGRL QAAAEICYDFIHDMAVDTIGPEGRAFFPFIFTLFFFILAGNYLGLLPFSFAFTSHIAVTL ALALLVFVLAVIVSLKAQGPKFFAHFMPAGAPVALAPLLVPIEILSFLSRPVSLSIRLFA NMVAGHVMLEMFAAFTIMLAGLGLFGDVLAVGPVVINVALMALELLVGALQAYVFAILTC IYLREAVAH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

iFluor™ 647 Conjugated EpCAM Recombinant Rabbit Monoclonal Antibody [PS01-69]
HA720185F 100 µL

iFluor™ 647 Conjugated EpCAM Recombinant Rabbit Monoclonal Antibody [PS01-69]

Sign In for Pricing
View Details
ACSM3 Human Gene Knockout Kit (CRISPR)
KN401099 1 Kit

ACSM3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
IgA Secretory Component (ECM1/792), CF647 conjugate, 0.1mg/mL
BNC470792-500 1x 500 µL

IgA Secretory Component (ECM1/792), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
rac Alpha-Lipoic Acid-d5
TRC-L468752-1MG 1 mg

rac Alpha-Lipoic Acid-d5

Sign In for Pricing
View Details
Mouse TF Antibody Pair Set
E-KAB-0576 50 µL & 100 µg

Mouse TF Antibody Pair Set

Sign In for Pricing
View Details
Taf5 Mouse Gene Knockout Kit (CRISPR)
KN517149 1 Kit

Taf5 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details