Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Gluconacetobacter diazotrophicus ATP synthase subunit a (atpB)

This Recombinant Gluconacetobacter diazotrophicus ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-249.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

A9HDN1

Expression Region

1-249

Origin

Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAAGSTIDALGQFELHPVLGGLGESLRFSQSPVMMIVASVLVLAFLYVGMRPAAIVPGRL QAAAEICYDFIHDMAVDTIGPEGRAFFPFIFTLFFFILAGNYLGLLPFSFAFTSHIAVTL ALALLVFVLAVIVSLKAQGPKFFAHFMPAGAPVALAPLLVPIEILSFLSRPVSLSIRLFA NMVAGHVMLEMFAAFTIMLAGLGLFGDVLAVGPVVINVALMALELLVGALQAYVFAILTC IYLREAVAH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SMURF 2 (SMURF2) (NM_022739) Human Over-expression Lysate
LC402939 20 µg

SMURF 2 (SMURF2) (NM_022739) Human Over-expression Lysate

Sign In for Pricing
View Details
Human SLC44A2 activation kit by CRISPRa
GA111412 1 Kit

Human SLC44A2 activation kit by CRISPRa

Sign In for Pricing
View Details
MFluor™ UV420 SE
1641-AAT 1 mg

MFluor™ UV420 SE

Sign In for Pricing
View Details
Human DOLPP1 activation kit by CRISPRa
GA111424 1 Kit

Human DOLPP1 activation kit by CRISPRa

Sign In for Pricing
View Details
RPC8 Antibody
8C15481-AAT 50 µg

RPC8 Antibody

Sign In for Pricing
View Details
Halo-Tag Monoclonal Antibody
AN004330L-01 25 µL

Halo-Tag Monoclonal Antibody

Sign In for Pricing
View Details