Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Agrobacterium tumefaciens ATP synthase subunit a (atpB)

This Recombinant Agrobacterium tumefaciens ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-249.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

A9CK03

Expression Region

1-249

Origin

Agrobacterium tumefaciens (strain C58 / ATCC 33970)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MANDPTHQFLVQPIIPIEIGGVDFSFTNASLFMVATVAAASGFLYFATSNRGLIPTRMQS VAEMSYEFIASMLREGAGKKGMVFFPFVFSLFMFVLTANLLGMFPYFFTVTSQIIVTFAL ACLVIGTVIVYGFYKHGLHFFGIFAPSGVPKALLPLVASIEMISFLSRPISLSVRLFANM LAGHITLKVFAGFVASMGALGALGVGGAVLPLIMTVAMTALEFLVAFLQAYVFAVLTCMY LNDAVHGGH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tsc22d4 Mouse Gene Knockout Kit (CRISPR)
KN518325 1 Kit

Tsc22d4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
17Alpha-Boldenone 17-Sulfate Triethylamine Salt - MOQ
TRC-B788220-25MG 25 mg

17Alpha-Boldenone 17-Sulfate Triethylamine Salt - MOQ

Sign In for Pricing
View Details
PAX8 (Renal Cell Marker) (PAX8/1492), CF568 conjugate, 0.1mg/mL
BNC681492-500 1x 500 µL

PAX8 (Renal Cell Marker) (PAX8/1492), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NCBP1 (NM_002486) Human Over-expression Lysate
LC419301 20 µg

NCBP1 (NM_002486) Human Over-expression Lysate

Sign In for Pricing
View Details
MRX-2843
TRC-M750145-5MG 5 mg

MRX-2843

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS516030 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details