Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Agrobacterium tumefaciens ATP synthase subunit a (atpB)

This Recombinant Agrobacterium tumefaciens ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-249.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

A9CK03

Expression Region

1-249

Origin

Agrobacterium tumefaciens (strain C58 / ATCC 33970)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MANDPTHQFLVQPIIPIEIGGVDFSFTNASLFMVATVAAASGFLYFATSNRGLIPTRMQS VAEMSYEFIASMLREGAGKKGMVFFPFVFSLFMFVLTANLLGMFPYFFTVTSQIIVTFAL ACLVIGTVIVYGFYKHGLHFFGIFAPSGVPKALLPLVASIEMISFLSRPISLSVRLFANM LAGHITLKVFAGFVASMGALGALGVGGAVLPLIMTVAMTALEFLVAFLQAYVFAVLTCMY LNDAVHGGH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Calbindin 1 (CALB1) (CALB1/2364), CF640R conjugate, 0.1mg/mL
BNC402364-500 1x 500 µL

Calbindin 1 (CALB1) (CALB1/2364), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TRIM5 alpha (TRIM5) (NM_033034) Human Over-expression Lysate
LC403221 20 µg

TRIM5 alpha (TRIM5) (NM_033034) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse Apoa2 activation kit by CRISPRa
GA200237 1 Kit

Mouse Apoa2 activation kit by CRISPRa

Sign In for Pricing
View Details
CCR5 Human Gene Knockout Kit (CRISPR)
KN216008LP 1 Kit

CCR5 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mycobacterium tuberculosis TaqMan PCR Kit Dx
DxTM42100 24 Reactions

Mycobacterium tuberculosis TaqMan PCR Kit Dx

Sign In for Pricing
View Details
Tissue FFPE Sections, Breast
CS801278 5x 5 µm

Tissue FFPE Sections, Breast

Sign In for Pricing
View Details