Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Agrobacterium tumefaciens ATP synthase subunit a (atpB)

This Recombinant Agrobacterium tumefaciens ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-249.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

A9CK03

Expression Region

1-249

Origin

Agrobacterium tumefaciens (strain C58 / ATCC 33970)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MANDPTHQFLVQPIIPIEIGGVDFSFTNASLFMVATVAAASGFLYFATSNRGLIPTRMQS VAEMSYEFIASMLREGAGKKGMVFFPFVFSLFMFVLTANLLGMFPYFFTVTSQIIVTFAL ACLVIGTVIVYGFYKHGLHFFGIFAPSGVPKALLPLVASIEMISFLSRPISLSVRLFANM LAGHITLKVFAGFVASMGALGALGVGGAVLPLIMTVAMTALEFLVAFLQAYVFAVLTCMY LNDAVHGGH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Colon: right
CS628391 5x 5 µm

Frozen Tissue Sections, Colon: right

Sign In for Pricing
View Details
LAT2 Antibody
KC-963-01 50 μL

LAT2 Antibody

Sign In for Pricing
View Details
LAT2 Antibody
KC-963-02 100 µL

LAT2 Antibody

Sign In for Pricing
View Details
LAT2 Antibody
KC-963-03 1 mL

LAT2 Antibody

Sign In for Pricing
View Details
Polystyrene A SH
HA12516004.0.5G 5 g

Polystyrene A SH

Sign In for Pricing
View Details
N-Nitrosooxprenolol
TRC-N137280-50MG 50 mg

N-Nitrosooxprenolol

Sign In for Pricing
View Details