Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Brucella abortus ATP synthase subunit a (atpB)

This Recombinant Brucella abortus ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-249.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

B2S9M8

Expression Region

1-249

Origin

Brucella abortus (strain S19)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MANDPIHQFQVSRWIPIDVGGVDLSFTNVSAFMVATVVLASGFLYLTSSGRGLIPTRLQS VSEMAYEFVATSLRDSAGSKGMKFFPFVFSLFMFVLVANFIGLFPYFYTVTSQIIVTFAL SLLVIGTVIFYGFFKHGFGFLKLFVPSGVPGIIVPLVVLIEIISFLSRPISLSVRLFANM LAGHITLKVFAGFVVSLSSLGALGIGGAVLPLLMTVAITALEFLVAFLQAYVFTVLTCMY INDAVHPGH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-Mouse IgG (H+L) antibody (AU)
STJ99357-1mL 1 mL

Rabbit Anti-Mouse IgG (H+L) antibody (AU)

Sign In for Pricing
View Details
USP21 3'UTR Lenti-reporter-Luc Vector
49299081 1.0 µg

USP21 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Human TEX10 Protein Lysate
MBS8428428-01 0.02 mg

Human TEX10 Protein Lysate

Sign In for Pricing
View Details
Human TEX10 Protein Lysate
MBS8428428-02 5x 0.02 mg

Human TEX10 Protein Lysate

Sign In for Pricing
View Details
TNIK, Phosphorylated (Ser769) (TRAF2 and NCK-interacting Kinase, KIAA0551) (Azide free) (HRP)
MBS6503206-01 0.2 mL

TNIK, Phosphorylated (Ser769) (TRAF2 and NCK-interacting Kinase, KIAA0551) (Azide free) (HRP)

Sign In for Pricing
View Details
TNIK, Phosphorylated (Ser769) (TRAF2 and NCK-interacting Kinase, KIAA0551) (Azide free) (HRP)
MBS6503206-02 5x 0.2 mL

TNIK, Phosphorylated (Ser769) (TRAF2 and NCK-interacting Kinase, KIAA0551) (Azide free) (HRP)

Sign In for Pricing
View Details