Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Brucella melitensis biotype 2 ATP synthase subunit a (atpB)

This Recombinant Brucella melitensis biotype 2 ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-249.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

C0RH93

Expression Region

1-249

Origin

Brucella melitensis biotype 2 (strain ATCC 23457)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MANDPIHQFQVSRWIPIDVGGVDLSFTNVSAFMVATVVLASGFLYLTSSGRGLIPTRLQS VSEMAYEFVATSLRDSAGSKGMKFFPFVFSLFMFVLVANFIGLFPYFYTVTSQIIVTFAL SLLVIGTVIFYGFFKHGFGFLKLFVPSGVPGIIVPLVVLIEIISFLSRPISLSVRLFANM LAGHITLKVFAGFVVSLSSLGALGIGGAVLPLLMTVAITALEFLVAFLQAYVFTVLTCMY INDAVHPGH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(AlphaS)-rel-Alpha-(4-Chlorophenyl)-Alpha-[(1R)-1-cyclopropylethyl]-1H-1,2,4-triazole-1-ethanol
TRC-C597055-25MG 25 mg

(AlphaS)-rel-Alpha-(4-Chlorophenyl)-Alpha-[(1R)-1-cyclopropylethyl]-1H-1,2,4-triazole-1-ethanol

Sign In for Pricing
View Details
CFC1 Antibody
OC-588-01 50 μL

CFC1 Antibody

Sign In for Pricing
View Details
CFC1 Antibody
OC-588-02 100 µL

CFC1 Antibody

Sign In for Pricing
View Details
CFC1 Antibody
OC-588-03 1 mL

CFC1 Antibody

Sign In for Pricing
View Details
ALK Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1A12]
TA801268BM 100 µL

ALK Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1A12]

Sign In for Pricing
View Details
BCL10 (MALT-Lymphoma Marker) (BL10/2988R), CF740 conjugate, 0.1mg/mL
BNC742988-100 1x 100 µL

BCL10 (MALT-Lymphoma Marker) (BL10/2988R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details