Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Brucella melitensis biotype 2 ATP synthase subunit a (atpB)

This Recombinant Brucella melitensis biotype 2 ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-249.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

C0RH93

Expression Region

1-249

Origin

Brucella melitensis biotype 2 (strain ATCC 23457)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MANDPIHQFQVSRWIPIDVGGVDLSFTNVSAFMVATVVLASGFLYLTSSGRGLIPTRLQS VSEMAYEFVATSLRDSAGSKGMKFFPFVFSLFMFVLVANFIGLFPYFYTVTSQIIVTFAL SLLVIGTVIFYGFFKHGFGFLKLFVPSGVPGIIVPLVVLIEIISFLSRPISLSVRLFANM LAGHITLKVFAGFVVSLSSLGALGIGGAVLPLLMTVAITALEFLVAFLQAYVFTVLTCMY INDAVHPGH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NET1 Peptide - N-terminal region
MBS3235575-01 0.1 mg

NET1 Peptide - N-terminal region

Sign In for Pricing
View Details
NET1 Peptide - N-terminal region
MBS3235575-02 5x 0.1 mg

NET1 Peptide - N-terminal region

Sign In for Pricing
View Details
Mouse Immunoglobulin M (IgM) ELISA Kit
GA-E0461MS-01 48 Tests

Mouse Immunoglobulin M (IgM) ELISA Kit

Sign In for Pricing
View Details
Mouse Immunoglobulin M (IgM) ELISA Kit
GA-E0461MS-02 96 Tests

Mouse Immunoglobulin M (IgM) ELISA Kit

Sign In for Pricing
View Details
Clostridium botulinum botA/BoNT Human Monoclonal Antibody
orb2959289-01 100 µg

Clostridium botulinum botA/BoNT Human Monoclonal Antibody

Sign In for Pricing
View Details
Clostridium botulinum botA/BoNT Human Monoclonal Antibody
orb2959289-02 1 mg

Clostridium botulinum botA/BoNT Human Monoclonal Antibody

Sign In for Pricing
View Details