Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Brucella melitensis biotype 2 ATP synthase subunit a (atpB)

This Recombinant Brucella melitensis biotype 2 ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-249.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

C0RH93

Expression Region

1-249

Origin

Brucella melitensis biotype 2 (strain ATCC 23457)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MANDPIHQFQVSRWIPIDVGGVDLSFTNVSAFMVATVVLASGFLYLTSSGRGLIPTRLQS VSEMAYEFVATSLRDSAGSKGMKFFPFVFSLFMFVLVANFIGLFPYFYTVTSQIIVTFAL SLLVIGTVIFYGFFKHGFGFLKLFVPSGVPGIIVPLVVLIEIISFLSRPISLSVRLFANM LAGHITLKVFAGFVVSLSSLGALGIGGAVLPLLMTVAITALEFLVAFLQAYVFTVLTCMY INDAVHPGH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Mnt Pre-designed siRNA Set A
SI108580A 1 Each

Mouse Mnt Pre-designed siRNA Set A

Sign In for Pricing
View Details
ABAT Rabbit Polyclonal Antibody (APC)
orb993762 100 µL

ABAT Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
PIK3C2B (Phosphoinositide-3-Kinase, Class 2, beta Polypeptide, C2-PI3K, DKFZp686G16234) (MaxLight 405) discontinued
250094-ML405 100 µL

PIK3C2B (Phosphoinositide-3-Kinase, Class 2, beta Polypeptide, C2-PI3K, DKFZp686G16234) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Recombinant Human HSP90AA1 Protein, N-GST & C-His
bs-104240P-01 20 µg

Recombinant Human HSP90AA1 Protein, N-GST & C-His

Sign In for Pricing
View Details
Recombinant Human HSP90AA1 Protein, N-GST & C-His
bs-104240P-02 50 µg

Recombinant Human HSP90AA1 Protein, N-GST & C-His

Sign In for Pricing
View Details
Rcvrn AAV siRNA Pooled Vector
38758166 1.0 µg

Rcvrn AAV siRNA Pooled Vector

Sign In for Pricing
View Details