Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Brucella suis ATP synthase subunit a (atpB)

This Recombinant Brucella suis ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-249.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

B0CK70

Expression Region

1-249

Origin

Brucella suis (strain ATCC 23445 / NCTC 10510)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MANDPIHQFQVSRWIPIDVGGVDLSFTNVSAFMVATVVLASGFLYLTSSGRGLIPTRLQS VSEMAYEFVATSLRDSAGSKGMKFFPFVFSLFMFVLVANFIGLFPYFYTVTSQIIVTFAL SLLVIGTVIFYGFFKHGFGFLKLFVPSGVPGIIVPLVVLIEIISFLSRPISLSVRLFANM LAGHITLKVFAGFVVSLSSLGALGIGGAVLPLLMTVAITALEFLVAFLQAYVFTVLTCMY INDAVHPGH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD59 (heavy chain of Protectin) (MACIF/629), CF740 conjugate, 0.1mg/mL
BNC740629-100 1x 100 µL

CD59 (heavy chain of Protectin) (MACIF/629), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
alpha Synuclein (SNCA) (also beta reactive) Mouse Monoclonal Antibody [Clone ID: 3B6]
AM09033PU-N 100 µL

alpha Synuclein (SNCA) (also beta reactive) Mouse Monoclonal Antibody [Clone ID: 3B6]

Sign In for Pricing
View Details
Smim10l1 Mouse Gene Knockout Kit (CRISPR)
KN500290 1 Kit

Smim10l1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Replication Protein A2 (RPA2) (RPA2/3140R), CF640R conjugate, 0.1mg/mL
BNC403140-100 1x 100 µL

Replication Protein A2 (RPA2) (RPA2/3140R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HCG-beta (hCGb/459), Biotin conjugate, 0.1mg/mL
BNCB0211-100 1x 100 µL

HCG-beta (hCGb/459), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GTPBP10 (C-term) Rabbit Polyclonal Antibody
AP51977PU-N 400 µL

GTPBP10 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details