Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Clostridium novyi Cobalamin synthase (cobS)

This Recombinant Clostridium novyi Cobalamin synthase (cobS) spans the amino acid sequence from region 1-250.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

A0Q0K0

Expression Region

1-250

Origin

Clostridium novyi (strain NT)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKNLILMIQFFTRIPINIEIDVKEDSFAKGISYLPLVGLIIGGFNAIVYFVSSKFILGTL PIVLALLANTIITGAFHIDGLADTCDGIFSSRKKERMLEIMKDSRVGTNGAIAIVFDFML RYAVLNSLNKKYIIIALILSPVVAKTVVTLLMCFSVYARKEGGLGGVFVGKVKPFRVIVA FIISISIGYVLIGYKYVALLLITVLFIEIYKKLIYSKIDGMTGDTLGAANEIAEIIFMLA LLSFKGCGLL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLEKHB1 CRISPRa sgRNA lentivector (set of three targets)(Rat)
36983126 3x 1.0µg DNA

PLEKHB1 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
XAF-1 Peptide
MBS152103-01 0.05 mg

XAF-1 Peptide

Sign In for Pricing
View Details
XAF-1 Peptide
MBS152103-02 5x 0.05 mg

XAF-1 Peptide

Sign In for Pricing
View Details
Goat Rabbit IgM (Fc specific), conjugated with Horseradish peroxidase Antibody
orb21470 1 mL

Goat Rabbit IgM (Fc specific), conjugated with Horseradish peroxidase Antibody

Sign In for Pricing
View Details
FGF2 Recombinant Antibody, AbBy Fluor™ 680 Conjugated
bsm-34016R-BF680 100 µL

FGF2 Recombinant Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
SBNO1 Rabbit Polyclonal Antibody (BF594)
orb2491769 100 µL

SBNO1 Rabbit Polyclonal Antibody (BF594)

Sign In for Pricing
View Details