Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Clostridium novyi Cobalamin synthase (cobS)

This Recombinant Clostridium novyi Cobalamin synthase (cobS) spans the amino acid sequence from region 1-250.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

A0Q0K0

Expression Region

1-250

Origin

Clostridium novyi (strain NT)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKNLILMIQFFTRIPINIEIDVKEDSFAKGISYLPLVGLIIGGFNAIVYFVSSKFILGTL PIVLALLANTIITGAFHIDGLADTCDGIFSSRKKERMLEIMKDSRVGTNGAIAIVFDFML RYAVLNSLNKKYIIIALILSPVVAKTVVTLLMCFSVYARKEGGLGGVFVGKVKPFRVIVA FIISISIGYVLIGYKYVALLLITVLFIEIYKKLIYSKIDGMTGDTLGAANEIAEIIFMLA LLSFKGCGLL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal ASAH2/N-acylsphingosine Amidohydrolase-2 Antibody [FITC]
NBP2-98205F 0.1 mL

Rabbit Polyclonal ASAH2/N-acylsphingosine Amidohydrolase-2 Antibody [FITC]

Sign In for Pricing
View Details
Menthyl Anthranilate
TRC-M219400-1G 1 g

Menthyl Anthranilate

Sign In for Pricing
View Details
TMEM120B
CSB-CL023688HU 10 μg Plasmid + 200 μL Glycerol

TMEM120B

Sign In for Pricing
View Details
Poliovirus Receptor/PVR Rabbit Polyclonal Antibody
orb738463 100 µg

Poliovirus Receptor/PVR Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Aquaporin 1/AQP1 Rabbit Polyclonal Antibody (Carrier-free)
orb3084025 100 µg

Aquaporin 1/AQP1 Rabbit Polyclonal Antibody (Carrier-free)

Sign In for Pricing
View Details
Rabbit Polyclonal PCYOX1L Antibody [mFluor Violet 610 SE]
NBP2-97684MFV610 0.1 mL

Rabbit Polyclonal PCYOX1L Antibody [mFluor Violet 610 SE]

Sign In for Pricing
View Details