Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pectobacterium carotovorum subsp. carotovorum UPF0259 membrane protein PC1_1998 (PC1_1998)

This Recombinant Pectobacterium carotovorum subsp. carotovorum UPF0259 membrane protein PC1_1998 (PC1_1998) spans the amino acid sequence from region 1-250.

Product Specifications

Product Name Alternative

UPF0259 membrane protein PC1_1998

UniProt

C6DGZ0

Expression Region

1-250

Origin

Pectobacterium carotovorum subsp. carotovorum (strain PC1)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPITANTLYRDTMNFTRNQFISILMMSLLTAFITVILNHALSPSVDELRILSSSGSDLSS SVESGLMDLIQQMTPEQQTVLLKMSAAGTFAALVGNVLLTGGVLMLIQLVSDGHRTSALR AIGASTPFLLRLLFLILLCTLLIQLGMMLLVIPGVLLAIALSLSPVIVVTEKSGIFSAIK ASTKLAYGNLRATAPAIVMWLLAKIAILLVVSKLPISSPTVLGVVLNGLSNLISAILLIY LFRLYMLLRA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSP27 (G3.1), CF740 conjugate, 0.1mg/mL
BNC740861-500 1x 500 µL

HSP27 (G3.1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Lambda Light Chain (LcN-2), CF405S conjugate, 0.1mg/mL
BNC040631-500 1x 500 µL

Human Lambda Light Chain (LcN-2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PLAP (Placental Alkaline Phosphatase) (GM022), CF647 conjugate, 0.1mg/mL
BNC470874-100 1x 100 µL

PLAP (Placental Alkaline Phosphatase) (GM022), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (T-Cell Marker) (SPN/2049R), CF640R conjugate, 0.1mg/mL
BNC402049-500 1x 500 µL

CD43 (T-Cell Marker) (SPN/2049R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Neurofilament (NF-H) (NF421), CF568 conjugate, 0.1mg/mL
BNC680421-500 1x 500 µL

Neurofilament (NF-H) (NF421), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P21 / WAF1 (DCS-60.2), CF568 conjugate, 0.1mg/mL
BNC680822-500 1x 500 µL

P21 / WAF1 (DCS-60.2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details