Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Thermoanaerobacter sp. Cobalamin synthase (cobS)

This Recombinant Thermoanaerobacter sp. Cobalamin synthase (cobS) spans the amino acid sequence from region 1-250.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

B0K2K2

Expression Region

1-250

Origin

Thermoanaerobacter sp. (strain X514)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEEIKRLVLAMQFMTHLPIPIEIDVEKSEFYKIASYFPIVGIVIGGILSLFYIALKDFFS REIVMTFIVAFSYVLTGAMHIDGLADTFDGLFSNKDKSKMLEIMRDSRLGTNGVLALVFM VVLKILFLTNINENITLTALLITPIIGRLSIVFSMMITKSARGGEGLGGLMLGKVGIREF AIAFVISIATSYFILPLAVFVKILTISLFVTYIVSKYISLRIGGMTGDTLGAVNELAELT ALICFVSVSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ZC3H14 activation kit by CRISPRa
GA112701 1 Kit

Human ZC3H14 activation kit by CRISPRa

Sign In for Pricing
View Details
Frozen Tissue Blocks, Ovary
CB507698 1 Block

Frozen Tissue Blocks, Ovary

Sign In for Pricing
View Details
1-(3-Chloropropyl)-1,3dihydrobenzimidazol-2-one (~90%)
TRC-C379825-10G 10 g

1-(3-Chloropropyl)-1,3dihydrobenzimidazol-2-one (~90%)

Sign In for Pricing
View Details
GPR83 Mouse Monoclonal Antibody [Clone ID: OTI3E8]
CF811836 100 µg

GPR83 Mouse Monoclonal Antibody [Clone ID: OTI3E8]

Sign In for Pricing
View Details
(3aR,4R,5R,6aS)-Hexahydro-5-hydroxy-4-(3-oxo-1-decenyl)-2H-cyclopenta[b]furan-2-one 5-(4-Phenylbenzoate)-d15
TRC-H294037-25MG 25 mg

(3aR,4R,5R,6aS)-Hexahydro-5-hydroxy-4-(3-oxo-1-decenyl)-2H-cyclopenta[b]furan-2-one 5-(4-Phenylbenzoate)-d15

Sign In for Pricing
View Details
Ethyl 2,3-Di-O-benzyl-4,6-O-benzylidene-1-deoxy-1-thio-alpha-D-mannopyranoside S-Oxide
TRC-E915775-50MG 50 mg

Ethyl 2,3-Di-O-benzyl-4,6-O-benzylidene-1-deoxy-1-thio-alpha-D-mannopyranoside S-Oxide

Sign In for Pricing
View Details