Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Thermoanaerobacter sp. Cobalamin synthase (cobS)

This Recombinant Thermoanaerobacter sp. Cobalamin synthase (cobS) spans the amino acid sequence from region 1-250.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

B0K2K2

Expression Region

1-250

Origin

Thermoanaerobacter sp. (strain X514)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEEIKRLVLAMQFMTHLPIPIEIDVEKSEFYKIASYFPIVGIVIGGILSLFYIALKDFFS REIVMTFIVAFSYVLTGAMHIDGLADTFDGLFSNKDKSKMLEIMRDSRLGTNGVLALVFM VVLKILFLTNINENITLTALLITPIIGRLSIVFSMMITKSARGGEGLGGLMLGKVGIREF AIAFVISIATSYFILPLAVFVKILTISLFVTYIVSKYISLRIGGMTGDTLGAVNELAELT ALICFVSVSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HIG2 (HILPDA) Human Gene Knockout Kit (CRISPR)
KN200185BN 1 Kit

HIG2 (HILPDA) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Protein Phosphatase 1 beta (PPP1CB) Rabbit Polyclonal Antibody
AP05034PU-N 100 µg

Protein Phosphatase 1 beta (PPP1CB) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ENTPD5 (NM_001249) Human Over-expression Lysate
LC420048 20 µg

ENTPD5 (NM_001249) Human Over-expression Lysate

Sign In for Pricing
View Details
Human GLT1D1 activation kit by CRISPRa
GA115496 1 Kit

Human GLT1D1 activation kit by CRISPRa

Sign In for Pricing
View Details
AANAT Polyclonal Antibody
E-AB-10969-01 20 µL

AANAT Polyclonal Antibody

Sign In for Pricing
View Details
AANAT Polyclonal Antibody
E-AB-10969-02 60 µL

AANAT Polyclonal Antibody

Sign In for Pricing
View Details