Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Thermoanaerobacter pseudethanolicus Cobalamin synthase (cobS)

This Recombinant Thermoanaerobacter pseudethanolicus Cobalamin synthase (cobS) spans the amino acid sequence from region 1-250.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

B0KCS0

Expression Region

1-250

Origin

Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) (Clostridium thermohydrosulfuricum)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEEIKRLVLAMQFMTRLPIPIEIDVEKREFYRIASYFPIVGIVIGGILSLLYIALKDFFS REIVMTFIVAFSYVLTGAMHIDGLADTFDGLFSNKDKSKMLEIMRDSRLGTNGVLAAIFI VVLKILFLTNIHENITLTALLITPIIGRLSIVFSMMISKSARGGEGLGGLMLGKVGIREF AIAFVISIATSYFILPLAVFVKILTISLFVTYIVSKYISLRIGGMTGDTLGAVNELAELT ALICFVSVSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cpxm1 Mouse Gene Knockout Kit (CRISPR)
KN503789 1 Kit

Cpxm1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SLC47A1 Human Gene Knockout Kit (CRISPR)
KN401890 1 Kit

SLC47A1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse Nell2 activation kit by CRISPRa
GA205629 1 Kit

Mouse Nell2 activation kit by CRISPRa

Sign In for Pricing
View Details
OR2A4/2A7 Antibody
8G536-AAT 50 µg

OR2A4/2A7 Antibody

Sign In for Pricing
View Details
2-(2-Chlorobenzoyloxy)acetophenone
TRC-C463410-500MG 500 mg

2-(2-Chlorobenzoyloxy)acetophenone

Sign In for Pricing
View Details
Kif26b Mouse Gene Knockout Kit (CRISPR)
KN308785 1 Kit

Kif26b Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details