Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Thermoanaerobacter pseudethanolicus Cobalamin synthase (cobS)

This Recombinant Thermoanaerobacter pseudethanolicus Cobalamin synthase (cobS) spans the amino acid sequence from region 1-250.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

B0KCS0

Expression Region

1-250

Origin

Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) (Clostridium thermohydrosulfuricum)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEEIKRLVLAMQFMTRLPIPIEIDVEKREFYRIASYFPIVGIVIGGILSLLYIALKDFFS REIVMTFIVAFSYVLTGAMHIDGLADTFDGLFSNKDKSKMLEIMRDSRLGTNGVLAAIFI VVLKILFLTNIHENITLTALLITPIIGRLSIVFSMMISKSARGGEGLGGLMLGKVGIREF AIAFVISIATSYFILPLAVFVKILTISLFVTYIVSKYISLRIGGMTGDTLGAVNELAELT ALICFVSVSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5-Nitro[1,1'-biphenyl]-2,2'-diamine
TRC-N494020-250MG 250 mg

5-Nitro[1,1'-biphenyl]-2,2'-diamine

Sign In for Pricing
View Details
Porcine IgM Mouse Monoclonal Antibody [Clone ID: 206-2]
AM03216PU-N 200 µg

Porcine IgM Mouse Monoclonal Antibody [Clone ID: 206-2]

Sign In for Pricing
View Details
ACTH (POMC) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4G4]
TA506615AM 100 µL

ACTH (POMC) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4G4]

Sign In for Pricing
View Details
CRTC3 Mouse Monoclonal Antibody [Clone ID: 5G9]
AM06581SU-N 100 µL

CRTC3 Mouse Monoclonal Antibody [Clone ID: 5G9]

Sign In for Pricing
View Details
6-Thioinosine Phosphate (~90%)
TRC-T344500-25MG 25 mg

6-Thioinosine Phosphate (~90%)

Sign In for Pricing
View Details
Cytokeratin 16 (KRT16) (Suprabasal Keratinocyte Marker) (KRT16/1714), 0.2mg/mL
BNUB1714-500 1x 500 µL

Cytokeratin 16 (KRT16) (Suprabasal Keratinocyte Marker) (KRT16/1714), 0.2mg/mL

Sign In for Pricing
View Details