Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii UPF0014 membrane protein MJ0938 (MJ0938)

This Recombinant Methanocaldococcus jannaschii UPF0014 membrane protein MJ0938 (MJ0938) spans the amino acid sequence from region 1-250.

Product Specifications

Product Name Alternative

UPF0014 membrane protein MJ0938

UniProt

Q58348

Expression Region

1-250

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIIKVMVMLLIELTYAFIFVIIAVLIAYREKLGIEKKILYVSILALIQLFILGFVLLYIF SFGMVGAFLMIGVMITLASYLIMREINLKNKTKLFICLFITFLTTTIVSLAVLTIPKVVK FEPIYVIPLMGMVIGNTMNTIHLALDKIIDMVKSERDILWGYLALGATEIEALRPFIKNA VKSAVIPQMNRTKSVGVIFIPGAMVGMLLSGANPIYAAEIQIIIMWMILSSAVISGILIC YLMYKEIIRA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 17 (E3), CF640R conjugate, 0.1mg/mL
BNC400158-100 1x 100 µL

Cytokeratin 17 (E3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P21 / WAF1 (WA-1), CF568 conjugate, 0.1mg/mL
BNC680043-500 1x 500 µL

P21 / WAF1 (WA-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF594 conjugate, 0.1mg/mL
BNC940391-500 1x 500 µL

CD81 / TAPA-1 (1.3.3.22), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP60 (LK1), CF488A conjugate, 0.1mg/mL
BNC880851-100 1x 100 µL

HSP60 (LK1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GLUT-1 (Tumor Progression and Mesothelioma Marker) (GLUT1/2475), CF594 conjugate, 0.1mg/mL
BNC942475-500 1x 500 µL

GLUT-1 (Tumor Progression and Mesothelioma Marker) (GLUT1/2475), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD1a / HTA1 (Mature Langerhans Cells Marker) (rC1A/711), CF740 conjugate, 0.1mg/mL
BNC741888-500 1x 500 µL

CD1a / HTA1 (Mature Langerhans Cells Marker) (rC1A/711), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details