Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Cytochrome b561 (Cyb561)

This Recombinant Mouse Cytochrome b561 (Cyb561) spans the amino acid sequence from region 1-250.

Product Specifications

Product Name Alternative

Cytochrome b561, Cytochrome b-561

UniProt

Q60720

Expression Region

1-250

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEHSSASVPAALPYYVAFSQLLGLTVVAVTGAWLGLYRGGIAWESSLQFNVHPLCMVIGM IFLQGDALLVYRVFRREAKRTTKILHGLLHVFAFIIALVGLVAVFDYHKKKGYADLYSLH SWCGILVFVLYFVQWLVGFSFFLFPGASFSLRSRYRPQHIFFGATIFLFSVGTALLGLKE ALLFKLGSKYSTFEPEGVLANVLGLLLVCFGVVVLYILAQADWKRPSQAEEQALSMDFKT LTEGDSPSPQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Purified Anti-Mouse CD18 Antibody[M18/2]
E-AB-F1113A-01 25 µg

Purified Anti-Mouse CD18 Antibody[M18/2]

Sign In for Pricing
View Details
Purified Anti-Mouse CD18 Antibody[M18/2]
E-AB-F1113A-02 100 µg

Purified Anti-Mouse CD18 Antibody[M18/2]

Sign In for Pricing
View Details
trFluor™ Tb-streptavidin conjugate
16926-AAT 100 µg

trFluor™ Tb-streptavidin conjugate

Sign In for Pricing
View Details
Cytokeratin 19 (KRT19/800), CF647 conjugate, 0.1mg/mL
BNC470800-100 1x 100 µL

Cytokeratin 19 (KRT19/800), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human CD200R1 Protein (His Tag)
PKSH031200 100 µg

Recombinant Human CD200R1 Protein (His Tag)

Sign In for Pricing
View Details
SARS-CoV-2 3C-like Proteinase Protein, Tag Free (active enzyme, MALS verified)
3CE-C5113-100ug 100 µg

SARS-CoV-2 3C-like Proteinase Protein, Tag Free (active enzyme, MALS verified)

Sign In for Pricing
View Details