Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Cytochrome b561 (Cyb561)

This Recombinant Mouse Cytochrome b561 (Cyb561) spans the amino acid sequence from region 1-250.

Product Specifications

Product Name Alternative

Cytochrome b561, Cytochrome b-561

UniProt

Q60720

Expression Region

1-250

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEHSSASVPAALPYYVAFSQLLGLTVVAVTGAWLGLYRGGIAWESSLQFNVHPLCMVIGM IFLQGDALLVYRVFRREAKRTTKILHGLLHVFAFIIALVGLVAVFDYHKKKGYADLYSLH SWCGILVFVLYFVQWLVGFSFFLFPGASFSLRSRYRPQHIFFGATIFLFSVGTALLGLKE ALLFKLGSKYSTFEPEGVLANVLGLLLVCFGVVVLYILAQADWKRPSQAEEQALSMDFKT LTEGDSPSPQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HLTF Recombinant Rabbit Monoclonal Antibody [JE35-59]
HA722329 100 µL

HLTF Recombinant Rabbit Monoclonal Antibody [JE35-59]

Sign In for Pricing
View Details
NK1R Antibody
8G402-AAT 50 µg

NK1R Antibody

Sign In for Pricing
View Details
Calbindin 1 (CALB1) (CALB1/2364), CF647 conjugate, 0.1mg/mL
BNC472364-100 1x 100 µL

Calbindin 1 (CALB1) (CALB1/2364), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SMAD3 pSer213 Rabbit Polyclonal Antibody
AP12710PU-N 400 µL

SMAD3 pSer213 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
WIPI2 (2A2), CF594 conjugate, 0.1mg/mL
BNC942904-100 1x 100 µL

WIPI2 (2A2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P57 / KIP2 (KIP2/880), CF647 conjugate, 0.1mg/mL
BNC470880-500 1x 500 µL

P57 / KIP2 (KIP2/880), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details