Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Agrobacterium vitis ATP synthase subunit a (atpB)

This Recombinant Agrobacterium vitis ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-250.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

B9JSF9

Expression Region

1-250

Origin

Agrobacterium vitis (strain S4 / ATCC BAA-846) (Rhizobium vitis (strain S4) )

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSNDPTHQFQIHKIVPIEIGGIDFSFTNASLFMVATVACAAGFLYFATSNRGLIPGRAQS VAEMSYEFVASMLREGAGSHGMKFFPMVFSLFMFVLTANLLGMMPYFFTITSQIVVTFAL AIFVIGTVLVYGFYKHGLGFLNLFVPSGVPGALLLLVVPIEVISFLSRPISLSIRLFANM LAGHITLKVFAGFVASLGSLGALGVGGALLPLAMTVALTGLEFLVAFLQAYVFAVLTCMY LNDAIHPGGH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD163 (Monocyte & Macrophage Marker) (M130/1210), CF640R conjugate, 0.1mg/mL
BNC401210-100 1x 100 µL

CD163 (Monocyte & Macrophage Marker) (M130/1210), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ghrelin (human) Trifluoroacetic Acid Salt
TRC-G932014-2.5MG 2.5 mg

Ghrelin (human) Trifluoroacetic Acid Salt

Sign In for Pricing
View Details
Mouse Fgd1 activation kit by CRISPRa
GA201390 1 Kit

Mouse Fgd1 activation kit by CRISPRa

Sign In for Pricing
View Details
Blocking One
03953-66 100 mL

Blocking One

Sign In for Pricing
View Details
Human TMEM132E activation kit by CRISPRa
GA114864 1 Kit

Human TMEM132E activation kit by CRISPRa

Sign In for Pricing
View Details
Myosin, Smooth Muscle Heavy Chain (MYH11/923 + SMMS-1), Biotin conjugate, 0.1mg/mL
BNCB1136-100 1x 100 µL

Myosin, Smooth Muscle Heavy Chain (MYH11/923 + SMMS-1), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details