Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Agrobacterium vitis ATP synthase subunit a (atpB)

This Recombinant Agrobacterium vitis ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-250.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

B9JSF9

Expression Region

1-250

Origin

Agrobacterium vitis (strain S4 / ATCC BAA-846) (Rhizobium vitis (strain S4) )

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSNDPTHQFQIHKIVPIEIGGIDFSFTNASLFMVATVACAAGFLYFATSNRGLIPGRAQS VAEMSYEFVASMLREGAGSHGMKFFPMVFSLFMFVLTANLLGMMPYFFTITSQIVVTFAL AIFVIGTVLVYGFYKHGLGFLNLFVPSGVPGALLLLVVPIEVISFLSRPISLSIRLFANM LAGHITLKVFAGFVASLGSLGALGVGGALLPLAMTVALTGLEFLVAFLQAYVFAVLTCMY LNDAIHPGGH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine TG Antibody Pair Set
E-KAB-0611 50 µL & 100 µg

Porcine TG Antibody Pair Set

Sign In for Pricing
View Details
Recombinant Chromogranin-A Antibody
RC-5269-01 50 μL

Recombinant Chromogranin-A Antibody

Sign In for Pricing
View Details
Recombinant Chromogranin-A Antibody
RC-5269-02 100 µL

Recombinant Chromogranin-A Antibody

Sign In for Pricing
View Details
Recombinant Chromogranin-A Antibody
RC-5269-03 1 mL

Recombinant Chromogranin-A Antibody

Sign In for Pricing
View Details
Cytochrome C (Mitochondrial Marker) (7H8.2C12), CF405S conjugate, 0.1mg/mL
BNC040183-500 1x 500 µL

Cytochrome C (Mitochondrial Marker) (7H8.2C12), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fusion glycoprotein F0 Rabbit Polyclonal Antibody
ER1802-33 100 µL

Fusion glycoprotein F0 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details