Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rhizobium sp. ATP synthase subunit a (atpB)

This Recombinant Rhizobium sp. ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-250.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

C3MHB5

Expression Region

1-250

Origin

Rhizobium sp. (strain NGR234)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSNDPTHQFLVNKIVPIEIGGIDFSFTNASLFMVATVGVAAGFLYLTTSQRGVIPTRMQS VSEVSYEFIASMLREGAGSHGMKFFPMVFSLFMFILTANLLGMFPYFFTVTSQIIVTFAL AVFVIGTVILYGFYKHGFGFLKLFVPHGVPGALLPLVVSIEVISFLSRPISLSVRLFANM LAGHITLKVFAGFVASLSAFGALGIGGAILPLIMTVALTGLEFLVAFLQAYVFAVLTCMY LNDAVHPGSH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse AMH (Anti-Mullerian Hormone) CLIA Kit
E-CL-M0090-01 24 Tests

Mouse AMH (Anti-Mullerian Hormone) CLIA Kit

Sign In for Pricing
View Details
Mouse AMH (Anti-Mullerian Hormone) CLIA Kit
E-CL-M0090-02 48 Tests

Mouse AMH (Anti-Mullerian Hormone) CLIA Kit

Sign In for Pricing
View Details
Mouse AMH (Anti-Mullerian Hormone) CLIA Kit
E-CL-M0090-03 96 Tests

Mouse AMH (Anti-Mullerian Hormone) CLIA Kit

Sign In for Pricing
View Details
MART-1 / Melan-A (M2-7C10 + M2-9E3 + A103), CF568 conjugate, 0.1mg/mL
BNC680700-500 1x 500 µL

MART-1 / Melan-A (M2-7C10 + M2-9E3 + A103), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant GGT1 Antibody
RC-16162-01 50 μL

Recombinant GGT1 Antibody

Sign In for Pricing
View Details
Recombinant GGT1 Antibody
RC-16162-02 100 µL

Recombinant GGT1 Antibody

Sign In for Pricing
View Details