Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Encephalitozoon hellem Aquaporin (AQP)

This Recombinant Encephalitozoon hellem Aquaporin (AQP) spans the amino acid sequence from region 1-251.

Product Specifications

Product Name Alternative

Aquaporin

UniProt

Q1M1A0

Expression Region

1-251

Origin

Encephalitozoon hellem (Microsporidian parasite)

Field of Research

Kidney & Urological Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAGETLRKIQSLLGEMVASFIFGFAVYSAILGSTIAQQPAAKVIIGLTVGFSAIGIIYSF SDVTIAHFNPAITLAAILTGKMGILCGLGYMLAQCVGFILAVCALLVCSPVGYKETLNVI RPAPAPFGADNLNVFFTEFFLTAILVHIAFAVAVNPYRPKVDTDGKFVDPDEKEPVDRRI TAPLCIGLTLGFLAFMGLVTSGGAFNPGLTLAPVIMSNTWQHFWLYLGAQYLGGLVGGLL QVFVLYKLSSN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOXP3 (3G3), CF555 conjugate, 0.1mg/mL
BNC550645-100 1x 100 µL

FOXP3 (3G3), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IgA Secretory Component (SC05), CF568 conjugate, 0.1mg/mL
BNC680050-500 1x 500 µL

IgA Secretory Component (SC05), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD28 (204.12), CF740 conjugate, 0.1mg/mL
BNC740164-500 1x 500 µL

CD28 (204.12), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HCG-beta (hCGb/459), CF405S conjugate, 0.1mg/mL
BNC040211-100 1x 100 µL

HCG-beta (hCGb/459), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HCG-beta (hCGb/459), CF740 conjugate, 0.1mg/mL
BNC740211-100 1x 100 µL

HCG-beta (hCGb/459), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
OCT-2 (POU2F2) (B-Cell Marker) (OCT2/2137), CF568 conjugate, 0.1mg/mL
BNC682137-500 1x 500 µL

OCT-2 (POU2F2) (B-Cell Marker) (OCT2/2137), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details