Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Caulobacter crescentus Flagellar biosynthetic protein fliR (fliR)

This Recombinant Caulobacter crescentus Flagellar biosynthetic protein fliR (fliR) spans the amino acid sequence from region 1-251.

Product Specifications

Product Name Alternative

Flagellar biosynthetic protein fliR

UniProt

Q45975

Expression Region

1-251

Origin

Caulobacter crescentus (strain ATCC 19089 / CB15)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNAFATAFQVYVAALVFARVGAMVMTMPGIGDQAIPARIRLSFALLMALILAPLVQNTVG PIPSTLGGLGGAVIHEVLIGLMIGSVLRLFMTSLTTAGEIISMQTTLSFAQSTNPSMEGS STAVATFLSMLGLTLVMATDLHHLFIAAIVKSYTIFPFTRAVPVNDAAALAVQTVAQSFS LGVQLAAPVIVFSLVFNLATGLVGRIMPAFQIFFVASPLSVILGLSLLALSLSGIAMVWT DRYRELLDIFT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Caspase-6 Antibody
F43295-0.08ML 0.08 mL

Caspase-6 Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Stomach
CS805520 5x 5 µm

Tissue FFPE Sections, Stomach

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Rat CD8a Antibody[OX-8]
E-AB-F1098UM1-01 25 µg

Elab Fluor® 700 Anti-Rat CD8a Antibody[OX-8]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Rat CD8a Antibody[OX-8]
E-AB-F1098UM1-02 100 µg

Elab Fluor® 700 Anti-Rat CD8a Antibody[OX-8]

Sign In for Pricing
View Details
Gfus Mouse Gene Knockout Kit (CRISPR)
KN518385 1 Kit

Gfus Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD56 / NCAM (123C3.D5), CF740 conjugate, 0.1mg/mL
BNC740015-500 1x 500 µL

CD56 / NCAM (123C3.D5), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details