Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus elongatus Cobalamin synthase (cobS)

This Recombinant Synechococcus elongatus Cobalamin synthase (cobS) spans the amino acid sequence from region 1-251.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

Q8GMS2

Expression Region

1-251

Origin

Synechococcus elongatus (strain PCC 7942) (Anacystis nidulans R2)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIRQLWTELNAAILFYTVLPLPQRWPTQFAGMSRWAPIVGLILGLILAVSDRLLAVGQFP LPLRSLLIVLLAIALTGGLHLDGAMDTADGLAVPNPDRRLEVMSDSHTGAFGAIAAIAII SLKTIALCYLPAPRSLLILLIPVWGRWAQVLAIVRYPYLKAEGKGAIHKQTGRGAIDLLP GAIALVLGIGAIARFHSLTVALQLLAIGLLWAWATGAWLQKKLGGQTGDTYGAIVEWTEA LIWVSFTIGQV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Freeze Dryer BFFT-310-A
BFFT-310-A 1 Unit

Freeze Dryer BFFT-310-A

Sign In for Pricing
View Details
Pure Bryonia dioica Lectin (White Bryony) -BDA-
L-8002-1 1 mg

Pure Bryonia dioica Lectin (White Bryony) -BDA-

Sign In for Pricing
View Details
RAB3IP Mouse Monoclonal Antibody [Clone ID: OTI5D1]
CF808961 100 µg

RAB3IP Mouse Monoclonal Antibody [Clone ID: OTI5D1]

Sign In for Pricing
View Details
Human Immunoglobulin Alpha (IgA) Heavy Chain (rHISA43), CF568 conjugate, 0.1mg/mL
BNC683876-500 1x 500 µL

Human Immunoglobulin Alpha (IgA) Heavy Chain (rHISA43), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
BstDSI, 500U
RE1214 500 U

BstDSI, 500U

Sign In for Pricing
View Details
RPL19 (NM_000981) Human Over-expression Lysate
LC400353 20 µg

RPL19 (NM_000981) Human Over-expression Lysate

Sign In for Pricing
View Details