Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acidiphilium cryptum ATP synthase subunit a (atpB)

This Recombinant Acidiphilium cryptum ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-251.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

A5FVJ0

Expression Region

1-251

Origin

Acidiphilium cryptum (strain JF-5)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAQESGINALGQFQLTTGFGAFGKAIEFTNSNEMMLLAAVIVTSLFVVALRQRALVPGRM QGLAEISYEFVHNMVLDTIGEEGKRFFPFVFTLFAFILIGNILGLFPYFFAFTSHIAITG ALALFVFALSTLVGFWYHGIGFLKFFSPPGVPGWLLPLLIPIEIVSFLSRPISLSVRLFA NITAGHVMWEVFAGFMLMLVSGLGAVGVVAAIIPLGLNIALTALEFLVAFLQAYVFAILT CLYLHDAIHMH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Canine Prestin ELISA kit
GTR10383699 96 Well

Canine Prestin ELISA kit

Sign In for Pricing
View Details
CD9P1, His, Mouse
Z04335-500 500 µg

CD9P1, His, Mouse

Sign In for Pricing
View Details
DNAJB6 (Center) Rabbit pAb
MBS8551736-01 0.1 mL

DNAJB6 (Center) Rabbit pAb

Sign In for Pricing
View Details
DNAJB6 (Center) Rabbit pAb
MBS8551736-02 0.1 mL (AF405L)

DNAJB6 (Center) Rabbit pAb

Sign In for Pricing
View Details
DNAJB6 (Center) Rabbit pAb
MBS8551736-03 0.1 mL (AF405S)

DNAJB6 (Center) Rabbit pAb

Sign In for Pricing
View Details
DNAJB6 (Center) Rabbit pAb
MBS8551736-04 0.1 mL (AF610)

DNAJB6 (Center) Rabbit pAb

Sign In for Pricing
View Details