Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acidiphilium cryptum ATP synthase subunit a (atpB)

This Recombinant Acidiphilium cryptum ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-251.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

A5FVJ0

Expression Region

1-251

Origin

Acidiphilium cryptum (strain JF-5)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAQESGINALGQFQLTTGFGAFGKAIEFTNSNEMMLLAAVIVTSLFVVALRQRALVPGRM QGLAEISYEFVHNMVLDTIGEEGKRFFPFVFTLFAFILIGNILGLFPYFFAFTSHIAITG ALALFVFALSTLVGFWYHGIGFLKFFSPPGVPGWLLPLLIPIEIVSFLSRPISLSVRLFA NITAGHVMWEVFAGFMLMLVSGLGAVGVVAAIIPLGLNIALTALEFLVAFLQAYVFAILT CLYLHDAIHMH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rat KAT5 Protein, His (Fc)-Avi-tagged
KAT5-2811R 50 µg

Recombinant Rat KAT5 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
CCDC44 (D-3) Alexa Fluor® 546
sc-398915 AF546 200 µg/mL

CCDC44 (D-3) Alexa Fluor® 546

Sign In for Pricing
View Details
TMEM173 Antibody, Biotin conjugated
CSB-PA023754LD01HU-01 50 µg

TMEM173 Antibody, Biotin conjugated

Sign In for Pricing
View Details
TMEM173 Antibody, Biotin conjugated
CSB-PA023754LD01HU-02 100 µg

TMEM173 Antibody, Biotin conjugated

Sign In for Pricing
View Details
Salmon Calcitonin (SCT) ELISA Kit
DLR-SCT-Ge-48T 48 Tests

Salmon Calcitonin (SCT) ELISA Kit

Sign In for Pricing
View Details
Staphylococcus aureus Protein A/SPA Antibody , PE
E55A10961 50 Tests

Staphylococcus aureus Protein A/SPA Antibody , PE

Sign In for Pricing
View Details