Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acidiphilium cryptum ATP synthase subunit a (atpB)

This Recombinant Acidiphilium cryptum ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-251.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

A5FVJ0

Expression Region

1-251

Origin

Acidiphilium cryptum (strain JF-5)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAQESGINALGQFQLTTGFGAFGKAIEFTNSNEMMLLAAVIVTSLFVVALRQRALVPGRM QGLAEISYEFVHNMVLDTIGEEGKRFFPFVFTLFAFILIGNILGLFPYFFAFTSHIAITG ALALFVFALSTLVGFWYHGIGFLKFFSPPGVPGWLLPLLIPIEIVSFLSRPISLSVRLFA NITAGHVMWEVFAGFMLMLVSGLGAVGVVAAIIPLGLNIALTALEFLVAFLQAYVFAILT CLYLHDAIHMH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P2RY13 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K1583105 3x 1.0 µg

P2RY13 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Mmu-miR-6356 miRNA Mimic
CMM1164-01 5 nmol

Mmu-miR-6356 miRNA Mimic

Sign In for Pricing
View Details
Mmu-miR-6356 miRNA Mimic
CMM1164-02 10 nmol

Mmu-miR-6356 miRNA Mimic

Sign In for Pricing
View Details
P2Y2 Rabbit pAb, IRDye 800CW conjugated
orb2891417 100 µL

P2Y2 Rabbit pAb, IRDye 800CW conjugated

Sign In for Pricing
View Details
Monoclonal Antibody to Procollagen III N-Terminal Propeptide (PIIINP)
TRV-0034118-01 20 µL

Monoclonal Antibody to Procollagen III N-Terminal Propeptide (PIIINP)

Sign In for Pricing
View Details
Monoclonal Antibody to Procollagen III N-Terminal Propeptide (PIIINP)
TRV-0034118-02 100 µL

Monoclonal Antibody to Procollagen III N-Terminal Propeptide (PIIINP)

Sign In for Pricing
View Details