Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chlorobium chlorochromatii Cobalamin synthase (cobS)

This Recombinant Chlorobium chlorochromatii Cobalamin synthase (cobS) spans the amino acid sequence from region 1-252.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

Q3ARQ6

Expression Region

1-252

Origin

Chlorobium chlorochromatii (strain CaD3)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLGGLVTALRTLTILPIPGKDAVTFSHSLYWFPFVGLLLGALLAALGYVGSLSGWHEFAA LLVVLGGIVLTRGMHADGLADVADGFWGGRSKEAALRIMKDPTVGSFGALALSGVMLLKW VAVVRLLSFGLFDVVMAGILLARLVQVLLASALPYARREAGTASAFVAGAGAPHAFSALL FTLALLFPFYTENFPTMLWLLGAALVAGSMVGMVSYRKIGGVTGDVLGAGSELTEVAVWI TGALLLSDYLLF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ANKS1A activation kit by CRISPRa
GA108196 1 Kit

Human ANKS1A activation kit by CRISPRa

Sign In for Pricing
View Details
Fabp7 (NM_021272) Mouse Tagged ORF Clone
MG200772 10 µg

Fabp7 (NM_021272) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
CD1a (O10 + C1A/711), CF640R conjugate, 0.1mg/mL
BNC400717-500 1x 500 µL

CD1a (O10 + C1A/711), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAG1 (GPAT3) Mouse Monoclonal Antibody [Clone ID: OTI6A3]
CF809767 100 µg

MAG1 (GPAT3) Mouse Monoclonal Antibody [Clone ID: OTI6A3]

Sign In for Pricing
View Details
Glycine t-Butyl Ester Hydrochloride
TRC-G625175-5G 5 g

Glycine t-Butyl Ester Hydrochloride

Sign In for Pricing
View Details
MAGEA11 Rabbit Polyclonal Antibody
TA365791 100 µL

MAGEA11 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details