Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chlorobium chlorochromatii Cobalamin synthase (cobS)

This Recombinant Chlorobium chlorochromatii Cobalamin synthase (cobS) spans the amino acid sequence from region 1-252.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

Q3ARQ6

Expression Region

1-252

Origin

Chlorobium chlorochromatii (strain CaD3)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLGGLVTALRTLTILPIPGKDAVTFSHSLYWFPFVGLLLGALLAALGYVGSLSGWHEFAA LLVVLGGIVLTRGMHADGLADVADGFWGGRSKEAALRIMKDPTVGSFGALALSGVMLLKW VAVVRLLSFGLFDVVMAGILLARLVQVLLASALPYARREAGTASAFVAGAGAPHAFSALL FTLALLFPFYTENFPTMLWLLGAALVAGSMVGMVSYRKIGGVTGDVLGAGSELTEVAVWI TGALLLSDYLLF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Ovary: left
CS638095 5x 5 µm

Frozen Tissue Sections, Ovary: left

Sign In for Pricing
View Details
Cytokeratin 8 (KRT8) Mouse Monoclonal Antibody [Clone ID: K8.8 + DC10]
AM50261PU-S 100 µg

Cytokeratin 8 (KRT8) Mouse Monoclonal Antibody [Clone ID: K8.8 + DC10]

Sign In for Pricing
View Details
NGF Recombinant Rabbit monoclonal Antibody [SI79-01]
ET1606-29-50UL 50 µL

NGF Recombinant Rabbit monoclonal Antibody [SI79-01]

Sign In for Pricing
View Details
Recombinant TIA1 Monoclonal Antibody
AN301676L-01 50 µL

Recombinant TIA1 Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant TIA1 Monoclonal Antibody
AN301676L-02 100 µL

Recombinant TIA1 Monoclonal Antibody

Sign In for Pricing
View Details
Prostatic Acid Phosphatase (ACPP) (269-282) Goat Polyclonal Antibody
AP31101PU-N 100 µg

Prostatic Acid Phosphatase (ACPP) (269-282) Goat Polyclonal Antibody

Sign In for Pricing
View Details