Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bartonella henselae ATP synthase subunit a (atpB)

This Recombinant Bartonella henselae ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-252.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

Q6G5L2

Expression Region

1-252

Origin

Bartonella henselae (strain ATCC 49882 / Houston 1) (Rochalimaea henselae)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTSHAPDPVHQFEVSRLINISIGNMDLSFTNVSFFIVATVVVSSVFLFISSSSRGLVPTR MQSVSEMAYEFVASTLRESSGVQGMQFFPLVFSLFTFILVANFIGLFPYFYTITSQIMIT FSLAMLVIFTVISYGFYKHGVGFLKLFVPSGVPVLILPLVTMIEVISFFSRPISLSLRLF ANMLAGHITLKVFSGFIVSMIGIGIMGVGGSILPLIMTVAITALEFLVAFLQAYVFTVLT CMYLNDAVHPGH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD56 (NCAM1) Mouse Monoclonal Antibody [Clone ID: LBI3H2]
AMM16813V 100 µL

CD56 (NCAM1) Mouse Monoclonal Antibody [Clone ID: LBI3H2]

Sign In for Pricing
View Details
GMPR2 (NM_001002002) Human Recombinant Protein
TP323106M 100 µg

GMPR2 (NM_001002002) Human Recombinant Protein

Sign In for Pricing
View Details
PCK1 (Phosphoenolpyruvate Carboxykinase 1, PEPCK-1, Pck1, Phosphoenolpyruvate Carboxykinase Cytosolic [GTP], PEP Carboxykinase, PEPCK, PEPCKC, PEPCK-C, Phosphoenolpyruvate Carboxylase, HGNC:8724, MGC22652) (MaxLight 750) discontinued
130994-ML750 100 µL

PCK1 (Phosphoenolpyruvate Carboxykinase 1, PEPCK-1, Pck1, Phosphoenolpyruvate Carboxykinase Cytosolic [GTP], PEP Carboxykinase, PEPCK, PEPCKC, PEPCK-C, Phosphoenolpyruvate Carboxylase, HGNC:8724, MGC22652) (MaxLight 750) discontinued

Sign In for Pricing
View Details
EAU NON POTABLE 250X26CARD-T1-P16 Pipe Markers for Water
N003423 4 Card (4 Marker (s) x 1 Card)

EAU NON POTABLE 250X26CARD-T1-P16 Pipe Markers for Water

Sign In for Pricing
View Details
SLC17A4 Antibody; FITC conjugated
MBS7003675-01 0.05 mg

SLC17A4 Antibody; FITC conjugated

Sign In for Pricing
View Details
SLC17A4 Antibody; FITC conjugated
MBS7003675-02 0.1 mg

SLC17A4 Antibody; FITC conjugated

Sign In for Pricing
View Details