Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bartonella henselae ATP synthase subunit a (atpB)

This Recombinant Bartonella henselae ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-252.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

Q6G5L2

Expression Region

1-252

Origin

Bartonella henselae (strain ATCC 49882 / Houston 1) (Rochalimaea henselae)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTSHAPDPVHQFEVSRLINISIGNMDLSFTNVSFFIVATVVVSSVFLFISSSSRGLVPTR MQSVSEMAYEFVASTLRESSGVQGMQFFPLVFSLFTFILVANFIGLFPYFYTITSQIMIT FSLAMLVIFTVISYGFYKHGVGFLKLFVPSGVPVLILPLVTMIEVISFFSRPISLSLRLF ANMLAGHITLKVFSGFIVSMIGIGIMGVGGSILPLIMTVAITALEFLVAFLQAYVFTVLT CMYLNDAVHPGH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal PEPD Antibody (S03-7E5)
NBP3-15074-100ul 100 µL

Rabbit Monoclonal PEPD Antibody (S03-7E5)

Sign In for Pricing
View Details
Human AGRP ELISA KIT (1 x 96 wells)
EA102305 96 Well

Human AGRP ELISA KIT (1 x 96 wells)

Sign In for Pricing
View Details
ELF4 Knockout THP-1 Cell Line
ARG0800 1 Million

ELF4 Knockout THP-1 Cell Line

Sign In for Pricing
View Details
Squalene epoxidase shRNA (m) Lentiviral Particles
sc-61609-V 200 µL

Squalene epoxidase shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
NPBW1 Polyclonal Antibody
UB-GEN-7233 100 µL

NPBW1 Polyclonal Antibody

Sign In for Pricing
View Details
Trap1a AAV siRNA Pooled Vector
47510164 1.0 µg

Trap1a AAV siRNA Pooled Vector

Sign In for Pricing
View Details